Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB8 Peptide - middle region

SERPINB8 Peptide - middle region

Product Specifications

Product Name Alternative

CAP2, PI8

UniProt

P50452

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB8 Rabbit Polyclonal Antibody (orb583720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942130

Preservative

Lyophilized powder

AA Sequence

KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin B (CTSB) (NM_001908) Human Recombinant Protein
TP720340L 500 µg

Cathepsin B (CTSB) (NM_001908) Human Recombinant Protein

Sign In for Pricing
View Details
SERTM1 (NM_203451) Human Over-expression Lysate
LC404296 20 µg

SERTM1 (NM_203451) Human Over-expression Lysate

Sign In for Pricing
View Details
CUTC (NM_015960) Human Recombinant Protein
TP305748M 100 µg

CUTC (NM_015960) Human Recombinant Protein

Sign In for Pricing
View Details
GNAS (C-term) Rabbit Polyclonal Antibody
AP51874PU-N 400 µL

GNAS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-hydrazino 2-CT Polystyrene
H10070.25G 25 g

Fmoc-hydrazino 2-CT Polystyrene

Sign In for Pricing
View Details
NRSN2 (C-term) Rabbit Polyclonal Antibody
AP52939PU-N 400 µL

NRSN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details