Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB8 Peptide - middle region

SERPINB8 Peptide - middle region

Product Specifications

Product Name Alternative

CAP2, PI8

UniProt

P50452

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB8 Rabbit Polyclonal Antibody (orb583720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942130

Preservative

Lyophilized powder

AA Sequence

KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,6-Diamino-2-thiouracil-13C,15N
TRC-D416817-10MG 10 mg

5,6-Diamino-2-thiouracil-13C,15N

Sign In for Pricing
View Details
Human FAM108A1 (ABHD17A) activation kit by CRISPRa
GA113153 1 Kit

Human FAM108A1 (ABHD17A) activation kit by CRISPRa

Sign In for Pricing
View Details
Scgb1c1 Mouse Gene Knockout Kit (CRISPR)
KN515363 1 Kit

Scgb1c1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SULt2a6 Mouse Gene Knockout Kit (CRISPR)
KN516971 1 Kit

SULt2a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Msi2 Mouse Gene Knockout Kit (CRISPR)
KN310426 1 Kit

Msi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details