Serpinc1 Peptide - C-terminal region
Serpinc1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI114908, ATIII, At-3, At3
UniProt
P32261
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Serpinc1 Rabbit Polyclonal Antibody (orb578042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_543120
Preservative
Lyophilized powder
AA Sequence
AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043280-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
1123-AAT 2 Labelings
ReadiLink™ Rapid mFluor™ Green 620 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
Sign In for Pricing
View Details 
AP13101PU-N 400 µL
EDG2 (LPAR1) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 