Serpinc1 Peptide - C-terminal region
Serpinc1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI114908, ATIII, At-3, At3
UniProt
P32261
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Serpinc1 Rabbit Polyclonal Antibody (orb578042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_543120
Preservative
Lyophilized powder
AA Sequence
AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN420358 1 Kit
Z DNA binding protein (ZBP1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
LC432861 20 µg
Lunatic Fringe (LFNG) (NM_001166355) Human Over-expression Lysate
Sign In for Pricing
View Details 
RDR-KCNJ5-Mu-01 96 Tests
Mouse Potassium Inwardly Rectifying Channel Subfamily J, Member 5 (KCNJ5) ELISA Kit
Sign In for Pricing
View Details