Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINI2 Peptide - middle region

SERPINI2 Peptide - middle region

Product Specifications

Product Name Alternative

MEPI, PANCPIN, PI14, TSA2004

UniProt

Q9JK88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINI2 Rabbit Polyclonal Antibody (orb330881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006208

Preservative

Lyophilized powder

AA Sequence

SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2 Rabbit Polyclonal Antibody (Angiotensin Converting Enzyme 2)
TA306149 100 µg

ACE2 Rabbit Polyclonal Antibody (Angiotensin Converting Enzyme 2)

Sign In for Pricing
View Details
OmniPAGE Mini Comb, 1 Prep, 1 Marker, 1mm thick
VS10-1-1 1 Each

OmniPAGE Mini Comb, 1 Prep, 1 Marker, 1mm thick

Sign In for Pricing
View Details
IL-17E, Recombinant, Rat (IL-17, IL17E, IL 17E, r-IL-17E, rr-IL-17, IL, interluekin) discontinued
301235 10 µg

IL-17E, Recombinant, Rat (IL-17, IL17E, IL 17E, r-IL-17E, rr-IL-17, IL, interluekin) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [Biotin]
NBP3-08313B 100 µL

Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [Biotin]

Sign In for Pricing
View Details
Cathepsin L1 (CTSL) Antibody (HRP)
abx314434-01 20 µg

Cathepsin L1 (CTSL) Antibody (HRP)

Sign In for Pricing
View Details
Cathepsin L1 (CTSL) Antibody (HRP)
abx314434-02 50 µg

Cathepsin L1 (CTSL) Antibody (HRP)

Sign In for Pricing
View Details