Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINI2 Peptide - middle region

SERPINI2 Peptide - middle region

Product Specifications

Product Name Alternative

MEPI, PANCPIN, PI14, TSA2004

UniProt

Q9JK88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINI2 Rabbit Polyclonal Antibody (orb330881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006208

Preservative

Lyophilized powder

AA Sequence

SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB23 (NM_001278668) Human Tagged ORF Clone
RC236809 10 µg

RAB23 (NM_001278668) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cynomolgus HER2/ErbB2 Protein, Fc Tag
PM319 50 µg

Cynomolgus HER2/ErbB2 Protein, Fc Tag

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha, Human (MIP-3a, Exodus, LARC) (MaxLight 490)
MBS6485984-01 0.1 mL

Macrophage Inflammatory Protein 3 alpha, Human (MIP-3a, Exodus, LARC) (MaxLight 490)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha, Human (MIP-3a, Exodus, LARC) (MaxLight 490)
MBS6485984-02 5x 0.1 mL

Macrophage Inflammatory Protein 3 alpha, Human (MIP-3a, Exodus, LARC) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Omega 1 (GSTo1) ELISA Kit
DL-GSTo1-Mu-01 48 Tests

Mouse Glutathione S Transferase Omega 1 (GSTo1) ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Omega 1 (GSTo1) ELISA Kit
DL-GSTo1-Mu-02 96 Tests

Mouse Glutathione S Transferase Omega 1 (GSTo1) ELISA Kit

Sign In for Pricing
View Details