Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sesn1 Peptide - C-terminal region

Sesn1 Peptide - C-terminal region

Product Specifications

UniProt

D3ZJU4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sesn1 Rabbit Polyclonal Antibody (orb582611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099866

Preservative

Lyophilized powder

AA Sequence

IWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEGS2 Human Gene Knockout Kit (CRISPR)
KN417308 1 Kit

DEGS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL-32 alpha protein (His Tag)
PKSH034116-01 20 µg

Recombinant Human IL-32 alpha protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-32 alpha protein (His Tag)
PKSH034116-02 100 µg

Recombinant Human IL-32 alpha protein (His Tag)

Sign In for Pricing
View Details
SOD1/Superoxide Dismutase Monoclonal Antibody
AN200019P 100 µL

SOD1/Superoxide Dismutase Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse AGR3 Protein (His Tag)
PKSM041359-01 10 µg

Recombinant Mouse AGR3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse AGR3 Protein (His Tag)
PKSM041359-02 50 µg

Recombinant Mouse AGR3 Protein (His Tag)

Sign In for Pricing
View Details