Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sesn1 Peptide - C-terminal region

Sesn1 Peptide - C-terminal region

Product Specifications

UniProt

D3ZJU4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sesn1 Rabbit Polyclonal Antibody (orb582611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099866

Preservative

Lyophilized powder

AA Sequence

IWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 alpha 6 (S100A6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F8]
TA800941BM 100 µL

S100 alpha 6 (S100A6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F8]

Sign In for Pricing
View Details
Recombinant Mouse IGFBP-7/IGFBP7 Protein (Fc Tag)
PKSM040344 100 µg

Recombinant Mouse IGFBP-7/IGFBP7 Protein (Fc Tag)

Sign In for Pricing
View Details
(R)-(-)-1-Amino-2-propanol
TRC-A628158-500MG 500 mg

(R)-(-)-1-Amino-2-propanol

Sign In for Pricing
View Details
CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]
TA811601BM 100 µL

CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561354 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Recombinant Mouse IGF-II protein (His Tag)
PKSM041521-01 20 µg

Recombinant Mouse IGF-II protein (His Tag)

Sign In for Pricing
View Details