Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SESN2 Peptide - C-terminal region

SESN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp761M0212, DKFZp761M02121, HI95, SES2, SEST2

UniProt

P58004

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SESN2 Rabbit Polyclonal Antibody (orb584739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113647

Preservative

Lyophilized powder

AA Sequence

LQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HIPK2 activation kit by CRISPRa
GA109198 1 Kit

Human HIPK2 activation kit by CRISPRa

Sign In for Pricing
View Details
ENTPD5 (NM_001249) Human Recombinant Protein
TP324300 20 µg

ENTPD5 (NM_001249) Human Recombinant Protein

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), 0.2mg/mL
BNUB0282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), 0.2mg/mL

Sign In for Pricing
View Details
NDUFB2 Human Gene Knockout Kit (CRISPR)
KN416095 1 Kit

NDUFB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAC3 Polyclonal Antibody
E-AB-18793-01 20 µL

RAC3 Polyclonal Antibody

Sign In for Pricing
View Details
RAC3 Polyclonal Antibody
E-AB-18793-02 60 µL

RAC3 Polyclonal Antibody

Sign In for Pricing
View Details