Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SESN2 Peptide - C-terminal region

SESN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp761M0212, DKFZp761M02121, HI95, SES2, SEST2

UniProt

P58004

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SESN2 Rabbit Polyclonal Antibody (orb584739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113647

Preservative

Lyophilized powder

AA Sequence

LQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (MYC909), CF640R conjugate, 0.1mg/mL
BNC400909-100 1x 100 µL

C-Myc (MYC909), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193A-01 25 µg

Purified Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
Purified Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193A-02 100 µg

Purified Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Human Knockdown Lysate
LY300280 100 µg

DNA PKcs (PRKDC) Human Knockdown Lysate

Sign In for Pricing
View Details
PRAC (PRAC1) (NM_032391) Human Over-expression Lysate
LC403160 20 µg

PRAC (PRAC1) (NM_032391) Human Over-expression Lysate

Sign In for Pricing
View Details
8,8'-(1,4-Butanediyl)bis-8-azaspiro[4.5]decane-7,9-dione
TRC-B690145-50MG 50 mg

8,8'-(1,4-Butanediyl)bis-8-azaspiro[4.5]decane-7,9-dione

Sign In for Pricing
View Details