Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SESN2 Peptide - N-terminal region

SESN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp761M0212, DKFZp761M02121, HI95, SES2, SEST2

UniProt

P58004

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SESN2 Rabbit Polyclonal Antibody (orb584740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113647

Preservative

Lyophilized powder

AA Sequence

LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIRE (NM_000658) Human Over-expression Lysate
LC424585 20 µg

AIRE (NM_000658) Human Over-expression Lysate

Sign In for Pricing
View Details
Polycystin 2 (PKD2) Human Gene Knockout Kit (CRISPR)
KN420948 1 Kit

Polycystin 2 (PKD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant ERBB3 Antibody
RC-16892-01 50 μL

Recombinant ERBB3 Antibody

Sign In for Pricing
View Details
Recombinant ERBB3 Antibody
RC-16892-02 100 µL

Recombinant ERBB3 Antibody

Sign In for Pricing
View Details
Recombinant ERBB3 Antibody
RC-16892-03 1 mL

Recombinant ERBB3 Antibody

Sign In for Pricing
View Details
Tchp Mouse Gene Knockout Kit (CRISPR)
KN517333 1 Kit

Tchp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details