Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD6 Peptide - middle region

SETD6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21148

UniProt

Q8TBK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETD6 Rabbit Polyclonal Antibody (orb581315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079136

Preservative

Lyophilized powder

AA Sequence

ELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acaryochloris marina ATP synthase subunit a 1 (atpB1), partial
MBS7071028 Inquire

Recombinant Acaryochloris marina ATP synthase subunit a 1 (atpB1), partial

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Mouse CD11b mAb
A26229-01 50 Tests

ABflo® 450 Rabbit anti-Mouse CD11b mAb

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Mouse CD11b mAb
A26229-02 100 Tests

ABflo® 450 Rabbit anti-Mouse CD11b mAb

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Mouse CD11b mAb
A26229-03 200 Tests

ABflo® 450 Rabbit anti-Mouse CD11b mAb

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Mouse CD11b mAb
A26229-04 500 Tests

ABflo® 450 Rabbit anti-Mouse CD11b mAb

Sign In for Pricing
View Details
Apolipoprotein E3 (Apo E3) (MaxLight 490)
A2299-76N-ML490 100 µL

Apolipoprotein E3 (Apo E3) (MaxLight 490)

Sign In for Pricing
View Details