Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD6 Peptide - middle region

SETD6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21148

UniProt

Q8TBK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETD6 Rabbit Polyclonal Antibody (orb581315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079136

Preservative

Lyophilized powder

AA Sequence

ELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptococcus Group A (Biotin) discontinued
138396-Biotin 100 µL

Streptococcus Group A (Biotin) discontinued

Sign In for Pricing
View Details
Hsa-miR-4679 agomir
HY-R01248A-01 5 nmol

Hsa-miR-4679 agomir

Sign In for Pricing
View Details
Hsa-miR-4679 agomir
HY-R01248A-02 20 nmol

Hsa-miR-4679 agomir

Sign In for Pricing
View Details
HHCM, CT (Hepatocellular carcinoma protein HHCM) (PE) discontinued
036533-PE 200 µL

HHCM, CT (Hepatocellular carcinoma protein HHCM) (PE) discontinued

Sign In for Pricing
View Details
CELSR2 Rabbit pAb
MBS9143279-01 0.02 mL

CELSR2 Rabbit pAb

Sign In for Pricing
View Details
CELSR2 Rabbit pAb
MBS9143279-02 0.1 mL

CELSR2 Rabbit pAb

Sign In for Pricing
View Details