Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B3 Peptide - middle region

SF3B3 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0017, RSE1, SAP130, SF3b130, STAF130

UniProt

Q15393

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3B3 Rabbit Polyclonal Antibody (orb577748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036558

Preservative

Lyophilized powder

AA Sequence

TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit
ELK6743-01 48 Tests

Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit

Sign In for Pricing
View Details
Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit
ELK6743-02 96 Tests

Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit

Sign In for Pricing
View Details
Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit
ELK6743-03 5x 96 Tests

Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit

Sign In for Pricing
View Details
Rptor Rabbit pAb
A18487 50 µL

Rptor Rabbit pAb

Sign In for Pricing
View Details
NUTF2 Antibody
A18846-100UG 100 µg

NUTF2 Antibody

Sign In for Pricing
View Details
RNF145 Protein Vector (Rat) (pPB-N-His)
PV301787 500 ng

RNF145 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details