Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B3 Peptide - middle region

SF3B3 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0017, RSE1, SAP130, SF3b130, STAF130

UniProt

Q15393

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3B3 Rabbit Polyclonal Antibody (orb577748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036558

Preservative

Lyophilized powder

AA Sequence

TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM65B Polyclonal Antibody, HRP Conjugated
bs-12370R-HRP 100 µL

FAM65B Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
7-Methylheptadecanoyl-CoA
orb3143647-01 50 mg

7-Methylheptadecanoyl-CoA

Sign In for Pricing
View Details
7-Methylheptadecanoyl-CoA
orb3143647-02 10 mg

7-Methylheptadecanoyl-CoA

Sign In for Pricing
View Details
Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit
MBS735320-01 48 Well

Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit

Sign In for Pricing
View Details
Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit
MBS735320-02 96 Well

Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit

Sign In for Pricing
View Details
Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit
MBS735320-03 5x 96 Well

Mouse Tartrate Resistant Acid Phosphatase+B742 ELISA Kit

Sign In for Pricing
View Details