Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFN Peptide - N-terminal region

SFN Peptide - N-terminal region

Product Specifications

Product Name Alternative

YWHAS

UniProt

P31947

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFN Rabbit Polyclonal Antibody (orb582481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006133

Preservative

Lyophilized powder

AA Sequence

VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HSP60 Antibody (4B9/89) [Janelia Fluor 646]
NBP2-22440JF646 0.1 mL

Mouse Monoclonal HSP60 Antibody (4B9/89) [Janelia Fluor 646]

Sign In for Pricing
View Details
Sprn sgRNA CRISPR Lentivector (Rat) (Target 3)
K6250204 1.0 µg DNA

Sprn sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Kalrn/Kalirin ELISA Kit
MBS2904368-01 48 Well

Mouse Kalrn/Kalirin ELISA Kit

Sign In for Pricing
View Details
Mouse Kalrn/Kalirin ELISA Kit
MBS2904368-02 96 Well

Mouse Kalrn/Kalirin ELISA Kit

Sign In for Pricing
View Details
Mouse Kalrn/Kalirin ELISA Kit
MBS2904368-03 5x 96 Well

Mouse Kalrn/Kalirin ELISA Kit

Sign In for Pricing
View Details
Mouse Kalrn/Kalirin ELISA Kit
MBS2904368-04 10x 96 Well

Mouse Kalrn/Kalirin ELISA Kit

Sign In for Pricing
View Details