Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFT2D3 Peptide - N-terminal region

SFT2D3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC5391

UniProt

Q587I9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFT2D3 Rabbit Polyclonal Antibody (orb584749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116129

Preservative

Lyophilized powder

AA Sequence

EYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TYKi Antibody
NBP2-82045 0.1 mg

Rabbit Polyclonal TYKi Antibody

Sign In for Pricing
View Details
Rbfa Rat shRNA Plasmid (Locus ID 307235)
TL705934 1 Kit

Rbfa Rat shRNA Plasmid (Locus ID 307235)

Sign In for Pricing
View Details
SEP15 Rabbit mAb
orb1564276-01 20 ul

SEP15 Rabbit mAb

Sign In for Pricing
View Details
SEP15 Rabbit mAb
orb1564276-02 50 µL

SEP15 Rabbit mAb

Sign In for Pricing
View Details
SEP15 Rabbit mAb
orb1564276-03 100 µL

SEP15 Rabbit mAb

Sign In for Pricing
View Details
MIXL1 CRISPR Knock Out 293T Cell Line (Human)
30161141 1x 10^6 Cells / 1.0 mL

MIXL1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details