Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFT2D3 Peptide - N-terminal region

SFT2D3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC5391

UniProt

Q587I9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFT2D3 Rabbit Polyclonal Antibody (orb584749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116129

Preservative

Lyophilized powder

AA Sequence

EYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Mouse Protein disulfide-isomerase (P4HB)
KTE70794-01 48 Tests

ELISA kit for Mouse Protein disulfide-isomerase (P4HB)

Sign In for Pricing
View Details
ELISA kit for Mouse Protein disulfide-isomerase (P4HB)
KTE70794-02 96 Tests

ELISA kit for Mouse Protein disulfide-isomerase (P4HB)

Sign In for Pricing
View Details
ELISA kit for Mouse Protein disulfide-isomerase (P4HB)
KTE70794-03 5x 96 Well

ELISA kit for Mouse Protein disulfide-isomerase (P4HB)

Sign In for Pricing
View Details
1-Hydroxychlorodiene Hemisuccinate
sc-213338 2.5 mg

1-Hydroxychlorodiene Hemisuccinate

Sign In for Pricing
View Details
CstF-50 Lentiviral Activation Particles (m2)
sc-426509-LAC-2 200 µL

CstF-50 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal PML Protein Antibody [Allophycocyanin]
NB100-59787APC 0.1 mL

Rabbit Polyclonal PML Protein Antibody [Allophycocyanin]

Sign In for Pricing
View Details