Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGPP1 Peptide - middle region

SGPP1 Peptide - middle region

Product Specifications

Product Name Alternative

SPPase1

UniProt

Q9BX95

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGPP1 Rabbit Polyclonal Antibody (orb580935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110418

Preservative

Lyophilized powder

AA Sequence

THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human EMP2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUEMP2AP404200UL 200 µL

Rabbit Anti Human EMP2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Anti-GTF2F2 Rabbit pAb
GB11928-50 50 μL

Anti-GTF2F2 Rabbit pAb

Sign In for Pricing
View Details
Gamma-tubulin complex component 6 (TUBGCP6) Human ELISA Kit
D6157 96 Tests

Gamma-tubulin complex component 6 (TUBGCP6) Human ELISA Kit

Sign In for Pricing
View Details
Mouse PR Domain Containing Protein 1 (PRDM1) ELISA Kit
EKU12510 96 Tests

Mouse PR Domain Containing Protein 1 (PRDM1) ELISA Kit

Sign In for Pricing
View Details
Phospho-MERTK Antibody BIOTIN-Conjugated
MBS543988-01 0.1 mg

Phospho-MERTK Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Phospho-MERTK Antibody BIOTIN-Conjugated
MBS543988-02 5x 0.1 mg

Phospho-MERTK Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details