Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGPP1 Peptide - middle region

SGPP1 Peptide - middle region

Product Specifications

Product Name Alternative

SPPase1

UniProt

Q9BX95

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGPP1 Rabbit Polyclonal Antibody (orb580935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110418

Preservative

Lyophilized powder

AA Sequence

THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Mouse mAb
MBS8551066-01 0.1 mL

STAT3 Mouse mAb

Sign In for Pricing
View Details
STAT3 Mouse mAb
MBS8551066-02 0.1 mL (AF405L)

STAT3 Mouse mAb

Sign In for Pricing
View Details
STAT3 Mouse mAb
MBS8551066-03 0.1 mL (AF405S)

STAT3 Mouse mAb

Sign In for Pricing
View Details
STAT3 Mouse mAb
MBS8551066-04 0.1 mL (AF610)

STAT3 Mouse mAb

Sign In for Pricing
View Details
STAT3 Mouse mAb
MBS8551066-05 0.1 mL (AF635)

STAT3 Mouse mAb

Sign In for Pricing
View Details
STAT3 Mouse mAb
MBS8551066-06 0.1 mL (APC)

STAT3 Mouse mAb

Sign In for Pricing
View Details