Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3BP5 Peptide - N-terminal region

SH3BP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAB

UniProt

B3KQW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3BP5 Rabbit Polyclonal Antibody (orb584658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018009

Preservative

Lyophilized powder

AA Sequence

MEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOH Rabbit Polyclonal Antibody
TA370316 100 µL

RHOH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(1’S,2'S)-Nicotine 1'-Oxide and (1’R,2'S)-Nicotine 1'-Oxide Mixture
TRC-N427510-250MG 250 mg

(1’S,2'S)-Nicotine 1'-Oxide and (1’R,2'S)-Nicotine 1'-Oxide Mixture

Sign In for Pricing
View Details
Purified Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]
E-AB-F1192A-01 25 µg

Purified Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]

Sign In for Pricing
View Details
Purified Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]
E-AB-F1192A-02 100 µg

Purified Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805913 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
LRRC10 Human Gene Knockout Kit (CRISPR)
KN212671BN 1 Kit

LRRC10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details