Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3BP5 Peptide - N-terminal region

SH3BP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SAB

UniProt

B3KQW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3BP5 Rabbit Polyclonal Antibody (orb584658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018009

Preservative

Lyophilized powder

AA Sequence

MEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 1-Oleoyl-2-linoleoyl-3-chloropropanediol-d5
TRC-O530502-25MG 25 mg

rac 1-Oleoyl-2-linoleoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details
PPP2R1B Rabbit Polyclonal Antibody
TA366327 100 µL

PPP2R1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C17orf75 Human Gene Knockout Kit (CRISPR)
KN401416 1 Kit

C17orf75 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UNC45A (NM_001039675) Human Over-expression Lysate
LY400420 100 µg

UNC45A (NM_001039675) Human Over-expression Lysate

Sign In for Pricing
View Details
FGFBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]
TA808312BM 100 µL

FGFBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]

Sign In for Pricing
View Details
ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)
KN204196BN 1 Kit

ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details