Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3gl3 Peptide - middle region

Sh3gl3 Peptide - middle region

Product Specifications

Product Name Alternative

EEN-B2, MGC118269, SH3P13, Sh3d2c, Sh3d2c2

UniProt

Q62421

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3gl3 Rabbit Polyclonal Antibody (orb583211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059096

Preservative

Lyophilized powder

AA Sequence

IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH5P4 Human qPCR Primer Pair (XM_208352)
HP221270 200 Reactions

ADH5P4 Human qPCR Primer Pair (XM_208352)

Sign In for Pricing
View Details
ALDH1L1 (C-term) Rabbit Polyclonal Antibody
AP14685PU-N 400 µL

ALDH1L1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(5S,5’S)-Dihydroxy Lysinonorleucine
TRC-D452900-5MG 5 mg

(5S,5’S)-Dihydroxy Lysinonorleucine

Sign In for Pricing
View Details
PAI1 Mouse Monoclonal Antibody [A9G8]
HA601152 100 µL

PAI1 Mouse Monoclonal Antibody [A9G8]

Sign In for Pricing
View Details
FAM23A (TMEM236) (NM_001098844) Human Over-expression Lysate
LC420364 20 µg

FAM23A (TMEM236) (NM_001098844) Human Over-expression Lysate

Sign In for Pricing
View Details
MAGI1 (NM_001033057) Human Over-expression Lysate
LY422358 100 µg

MAGI1 (NM_001033057) Human Over-expression Lysate

Sign In for Pricing
View Details