Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3gl3 Peptide - middle region

Sh3gl3 Peptide - middle region

Product Specifications

Product Name Alternative

EEN-B2, MGC118269, SH3P13, Sh3d2c, Sh3d2c2

UniProt

Q62421

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3gl3 Rabbit Polyclonal Antibody (orb583211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059096

Preservative

Lyophilized powder

AA Sequence

IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL
BNC881969-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD564488 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details
Tissue Total RNA, Brain
CR559775 5 µg

Tissue Total RNA, Brain

Sign In for Pricing
View Details
USP9X Human Gene Knockout Kit (CRISPR)
KN417531 1 Kit

USP9X Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF640R conjugate, 0.1mg/mL
BNC402075-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CPNE1 (NM_152928) Human Recombinant Protein
TP312736 20 µg

CPNE1 (NM_152928) Human Recombinant Protein

Sign In for Pricing
View Details