Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3glb1 Peptide - N-terminal region

Sh3glb1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA409932, AI314629, AU015566, Bif-1, KIAA0491, mKIAA0491

UniProt

Q9JK48

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3glb1 Rabbit Polyclonal Antibody (orb331006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062337

Preservative

Lyophilized powder

AA Sequence

KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR141 (NM_181791) Human Over-expression Lysate
LC403629 20 µg

GPR141 (NM_181791) Human Over-expression Lysate

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-01 20 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-02 60 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-03 120 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-04 200 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details
SDHB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E4]
TA808115AM 100 µL

SDHB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E4]

Sign In for Pricing
View Details