Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3glb1 Peptide - N-terminal region

Sh3glb1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA409932, AI314629, AU015566, Bif-1, KIAA0491, mKIAA0491

UniProt

Q9JK48

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sh3glb1 Rabbit Polyclonal Antibody (orb331006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062337

Preservative

Lyophilized powder

AA Sequence

KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4A Rabbit Polyclonal Antibody
TA365006 100 µL

SEMA4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD147 Antibody[HIM6]
E-AB-F1056C-01 20 Tests

FITC Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
FITC Anti-Human CD147 Antibody[HIM6]
E-AB-F1056C-02 100 Tests

FITC Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
FITC Anti-Human CD147 Antibody[HIM6]
E-AB-F1056C-03 2x 100 Tests

FITC Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Glucoheptono-1,4-lactone
TRC-G416500-250MG 250 mg

D-Glucoheptono-1,4-lactone

Sign In for Pricing
View Details