Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHARPIN Peptide - C-terminal region

SHARPIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434N1923, SIPL1

UniProt

Q9H0F6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112236

Preservative

Lyophilized powder

AA Sequence

SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Section, Human Adult Normal, Colon (Paraffin Block)
MBS641008-01 0.1 mg

Tissue, Section, Human Adult Normal, Colon (Paraffin Block)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Colon (Paraffin Block)
MBS641008-02 5x 0.1 mg

Tissue, Section, Human Adult Normal, Colon (Paraffin Block)

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR3/TNFRSF10C Antibody (B-D44) [PE]
NBP3-14580PE 0.1 mL

Mouse Monoclonal TRAILR3/TNFRSF10C Antibody (B-D44) [PE]

Sign In for Pricing
View Details
RG9MTD3 (TRMT10B) (NM_001286950) Human Untagged Clone
SC334877 10 µg

RG9MTD3 (TRMT10B) (NM_001286950) Human Untagged Clone

Sign In for Pricing
View Details
1- (2-Cyanophenyl) piperazine
407541-01 100 mg

1- (2-Cyanophenyl) piperazine

Sign In for Pricing
View Details
1- (2-Cyanophenyl) piperazine
407541-02 250 mg

1- (2-Cyanophenyl) piperazine

Sign In for Pricing
View Details