Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHARPIN Peptide - C-terminal region

SHARPIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434N1923, SIPL1

UniProt

Q9H0F6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112236

Preservative

Lyophilized powder

AA Sequence

SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M9 CytoSection
TS424297P5 25 Slides

OR5M9 CytoSection

Sign In for Pricing
View Details
Human RBM20 siRNA
abx904495-01 15 nmol

Human RBM20 siRNA

Sign In for Pricing
View Details
Human RBM20 siRNA
abx904495-02 30 nmol

Human RBM20 siRNA

Sign In for Pricing
View Details
Proteasome Subunit Alpha Type 6 (PSMa6) Magnetic Luminex Assay Kit
LKU603335 96 Tests

Proteasome Subunit Alpha Type 6 (PSMa6) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Peptide YY (PYY) BioAssayTM ELISA Kit (Human)
027336-01 48 Tests

Peptide YY (PYY) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Peptide YY (PYY) BioAssayTM ELISA Kit (Human)
027336-02 96 Tests

Peptide YY (PYY) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details