Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1L Peptide - C-terminal region

SHCBP1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

GE36, MGC26911, MGC48296, SHCBP1L, C1orf14

UniProt

Q9BZQ2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHCBP1L Rabbit Polyclonal Antibody (orb582231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112195

Preservative

Lyophilized powder

AA Sequence

ITGAQGAGVELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP95 Human Gene Knockout Kit (CRISPR)
KN402579 1 Kit

CEP95 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tfpt Mouse Gene Knockout Kit (CRISPR)
KN517476 1 Kit

Tfpt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OLFmL3 activation kit by CRISPRa
GA111290 1 Kit

Human OLFmL3 activation kit by CRISPRa

Sign In for Pricing
View Details
IL17A Antibody
KC-3000-01 50 μL

IL17A Antibody

Sign In for Pricing
View Details
IL17A Antibody
KC-3000-02 100 µL

IL17A Antibody

Sign In for Pricing
View Details
IL17A Antibody
KC-3000-03 1 mL

IL17A Antibody

Sign In for Pricing
View Details