Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1L Peptide - C-terminal region

SHCBP1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

GE36, MGC26911, MGC48296, SHCBP1L, C1orf14

UniProt

Q9BZQ2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHCBP1L Rabbit Polyclonal Antibody (orb582231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112195

Preservative

Lyophilized powder

AA Sequence

ITGAQGAGVELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GelGreen® Agarose LE
#41030-50G 1x 50 g

GelGreen® Agarose LE

Sign In for Pricing
View Details
POLR1B Rabbit Polyclonal Antibody
TA380133 100 µL

POLR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100B (S100B/1012), CF647 conjugate, 0.1mg/mL
BNC471012-500 1x 500 µL

S100B (S100B/1012), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HNRNPC (NM_004500) Human Over-expression Lysate
LC401430 20 µg

HNRNPC (NM_004500) Human Over-expression Lysate

Sign In for Pricing
View Details
MN1 Antibody
8C10914-AAT 50 µg

MN1 Antibody

Sign In for Pricing
View Details
LYVE1 Mouse Monoclonal Antibody [Clone ID: OTI8E10]
CF812226 100 µg

LYVE1 Mouse Monoclonal Antibody [Clone ID: OTI8E10]

Sign In for Pricing
View Details