Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shkbp1 Peptide - N-terminal region

Shkbp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B930062H15Rik, Sb1

UniProt

Q6P7W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Shkbp1 Rabbit Polyclonal Antibody (orb575475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619617

Preservative

Lyophilized powder

AA Sequence

RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USHBP1 (NM_031941) Human Recombinant Protein
TP306394 20 µg

USHBP1 (NM_031941) Human Recombinant Protein

Sign In for Pricing
View Details
SDCG1 Antibody
8C10140-AAT 50 µg

SDCG1 Antibody

Sign In for Pricing
View Details
Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-01 24 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-02 48 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-03 96 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
Acetylcholine-1,1,2,2-d4 Bromide
TRC-A172072-10MG 10 mg

Acetylcholine-1,1,2,2-d4 Bromide

Sign In for Pricing
View Details