Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shkbp1 Peptide - N-terminal region

Shkbp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B930062H15Rik, Sb1

UniProt

Q6P7W2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Shkbp1 Rabbit Polyclonal Antibody (orb575475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619617

Preservative

Lyophilized powder

AA Sequence

RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ido1 Mouse Gene Knockout Kit (CRISPR)
KN308091 1 Kit

Ido1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uracil-d4
TRC-U801003-25MG 25 mg

Uracil-d4

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), 0.2mg/mL
BNUB1029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), Biotin conjugate, 0.1mg/mL
BNCB1877-500 1x 500 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
High Temperature Circulator BCHT-102
BCHT-102 1 Unit

High Temperature Circulator BCHT-102

Sign In for Pricing
View Details
PE Anti-Human CD19 Antibody[CB19]
E-AB-F1004D-01 20 Tests

PE Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details