Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHMT1 Peptide - N-terminal region

SHMT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSHMT, MGC15229, MGC24556, SHMT

UniProt

Q5RFK5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHMT1 Rabbit Polyclonal Antibody (orb580630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004160

Preservative

Lyophilized powder

AA Sequence

NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpsf7 3'UTR Lenti-reporter-Luc Vector
16784086 1.0 µg

Cpsf7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Microfibrillar-associated protein 1 (MFAP1) Bovine ELISA Kit
E9907 96 Tests

Microfibrillar-associated protein 1 (MFAP1) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial
CSB-BP859518HU-01 20 µg

Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial
CSB-BP859518HU-02 100 µg

Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial
CSB-BP859518HU-03 1 mg

Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial

Sign In for Pricing
View Details
Anti-FSTL5 Antibody
CQA4502-01 30 µL

Anti-FSTL5 Antibody

Sign In for Pricing
View Details