Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHMT1 Peptide - N-terminal region

SHMT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSHMT, MGC15229, MGC24556, SHMT

UniProt

Q5RFK5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHMT1 Rabbit Polyclonal Antibody (orb580630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004160

Preservative

Lyophilized powder

AA Sequence

NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CANX antibody
FNab01210 100 µg

CANX antibody

Sign In for Pricing
View Details
Lentiviral mouse Gal3st4 shRNA (UAS) - Lentiviral mouse Gal3st4 shRNA (UAS, iRFP) (25)
GTR15184190 1 Vial

Lentiviral mouse Gal3st4 shRNA (UAS) - Lentiviral mouse Gal3st4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ATP6V1H Overexpression Lysate (Native) - (Dry Ice)
NBL1-07847 0.1 mg

ATP6V1H Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Rabbit mAb
MBS9470467-01 0.05 mL

Placental alkaline phosphatase (PLAP) Rabbit mAb

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Rabbit mAb
MBS9470467-02 0.1 mL

Placental alkaline phosphatase (PLAP) Rabbit mAb

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Rabbit mAb
MBS9470467-03 5x 0.1 mL

Placental alkaline phosphatase (PLAP) Rabbit mAb

Sign In for Pricing
View Details