Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sik1 Peptide - middle region

Sik1 Peptide - middle region

Product Specifications

Product Name Alternative

Sik, Snf1lk

UniProt

Q9R1U5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sik1 Rabbit Polyclonal Antibody (orb579611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067725

Preservative

Lyophilized powder

AA Sequence

TPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPV1 Rabbit Polyclonal Antibody (PerCP)
orb2442730 100 µL

TRPV1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Cyclin A1 Conjugated Antibody
MBS9444346-01 0.1 mL (Biotin)

Cyclin A1 Conjugated Antibody

Sign In for Pricing
View Details
Cyclin A1 Conjugated Antibody
MBS9444346-02 0.1 mL (AF350)

Cyclin A1 Conjugated Antibody

Sign In for Pricing
View Details
Cyclin A1 Conjugated Antibody
MBS9444346-03 0.1 mL (AF405)

Cyclin A1 Conjugated Antibody

Sign In for Pricing
View Details
Cyclin A1 Conjugated Antibody
MBS9444346-04 0.1 mL (AF488)

Cyclin A1 Conjugated Antibody

Sign In for Pricing
View Details
Cyclin A1 Conjugated Antibody
MBS9444346-05 0.1 mL (AF555)

Cyclin A1 Conjugated Antibody

Sign In for Pricing
View Details