Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sik1 Peptide - middle region

Sik1 Peptide - middle region

Product Specifications

Product Name Alternative

Sik, Snf1lk

UniProt

Q9R1U5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sik1 Rabbit Polyclonal Antibody (orb579611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067725

Preservative

Lyophilized powder

AA Sequence

TPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NKG2DL (C-Fc)
PHH1788-01 10 µg

Recombinant Human NKG2DL (C-Fc)

Sign In for Pricing
View Details
Recombinant Human NKG2DL (C-Fc)
PHH1788-02 50 µg

Recombinant Human NKG2DL (C-Fc)

Sign In for Pricing
View Details
Recombinant Human NKG2DL (C-Fc)
PHH1788-03 500 µg

Recombinant Human NKG2DL (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse KRT18 Protein (His Tag)
MBS2580824-01 0.02 mg

Recombinant Mouse KRT18 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse KRT18 Protein (His Tag)
MBS2580824-02 0.1 mg

Recombinant Mouse KRT18 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse KRT18 Protein (His Tag)
MBS2580824-03 5x 0.1 mg

Recombinant Mouse KRT18 Protein (His Tag)

Sign In for Pricing
View Details