Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIK2 Peptide - N-terminal region

SIK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2

UniProt

Q9H0K1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIK2 Rabbit Polyclonal Antibody (orb585404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056006

Preservative

Lyophilized powder

AA Sequence

VLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612058-01 48 Well

Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612058-02 96 Well

Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612058-03 5x 96 Well

Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612058-04 10x 96 Well

Bovine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
MIM1 25mg
A16315-25 25 mg

MIM1 25mg

Sign In for Pricing
View Details
FBXO38 Protein Vector (Human) (pPM-C-HA)
PV015891 500 ng

FBXO38 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details