Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sip1 Peptide - N-terminal region

Sip1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700012N19Rik, Gemin2, Sip1

UniProt

Q9CQQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sip1 Rabbit Polyclonal Antibody (orb577518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079932

Preservative

Lyophilized powder

AA Sequence

PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ20259 Rabbit Polyclonal Antibody (RBITC)
orb1066591 100 µL

FLJ20259 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
TAL1 (BHLHA17, SCL, TCL5) discontinued
514827 100 µg

TAL1 (BHLHA17, SCL, TCL5) discontinued

Sign In for Pricing
View Details
ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)
TRV-0051193-01 24 Tests

ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)

Sign In for Pricing
View Details
ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)
TRV-0051193-02 48 Tests

ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)

Sign In for Pricing
View Details
ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)
TRV-0051193-03 96 Tests

ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)

Sign In for Pricing
View Details
ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)
TRV-0051193-04 5x 96 Tests

ELISA Kit for Creatine Kinase MB Isoenzyme (CKMB)

Sign In for Pricing
View Details