Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPG Peptide - middle region

SIRPG Peptide - middle region

Product Specifications

Product Name Alternative

CD172g, FLJ42230, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1

UniProt

O75131

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIRPG Rabbit Polyclonal Antibody (orb585359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003900

Preservative

Lyophilized powder

AA Sequence

ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHDC8A Antibody
orb1242019 100 µL

KLHDC8A Antibody

Sign In for Pricing
View Details
XRCC5 (X-Ray Repair Cross-Complementing Protein 5, 86kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 2, ATP-Dependent DNA Helicase II 80kD Subunit, CTC box-Binding Factor 85kD Subunit, CTC85, CTCBF, DNA Repair Protein XRCC5, Ku80, Ku86, Ku-80, Ku-86, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in Chinese hamster Cells 5 (double-strand-break rejoining), XRCC5, G22P2) discontinued
226724-01 50 µL

XRCC5 (X-Ray Repair Cross-Complementing Protein 5, 86kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 2, ATP-Dependent DNA Helicase II 80kD Subunit, CTC box-Binding Factor 85kD Subunit, CTC85, CTCBF, DNA Repair Protein XRCC5, Ku80, Ku86, Ku-80, Ku-86, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in Chinese hamster Cells 5 (double-strand-break rejoining), XRCC5, G22P2) discontinued

Sign In for Pricing
View Details
XRCC5 (X-Ray Repair Cross-Complementing Protein 5, 86kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 2, ATP-Dependent DNA Helicase II 80kD Subunit, CTC box-Binding Factor 85kD Subunit, CTC85, CTCBF, DNA Repair Protein XRCC5, Ku80, Ku86, Ku-80, Ku-86, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in Chinese hamster Cells 5 (double-strand-break rejoining), XRCC5, G22P2) discontinued
226724-02 100 µL

XRCC5 (X-Ray Repair Cross-Complementing Protein 5, 86kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 2, ATP-Dependent DNA Helicase II 80kD Subunit, CTC box-Binding Factor 85kD Subunit, CTC85, CTCBF, DNA Repair Protein XRCC5, Ku80, Ku86, Ku-80, Ku-86, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in Chinese hamster Cells 5 (double-strand-break rejoining), XRCC5, G22P2) discontinued

Sign In for Pricing
View Details
Lentiviral human ENG shRNA (UAS) - Lentiviral human ENG shRNA (UAS, GFP) plasmid
GTR15091522 1 Vial

Lentiviral human ENG shRNA (UAS) - Lentiviral human ENG shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PARP1 Antibody
orb689132-01 50 μL

PARP1 Antibody

Sign In for Pricing
View Details
PARP1 Antibody
orb689132-02 100 µL

PARP1 Antibody

Sign In for Pricing
View Details