Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPG Peptide - middle region

SIRPG Peptide - middle region

Product Specifications

Product Name Alternative

CD172g, FLJ42230, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1

UniProt

O75131

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIRPG Rabbit Polyclonal Antibody (orb585359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003900

Preservative

Lyophilized powder

AA Sequence

ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT17 Antibody, Biotin conjugated
CSB-PA743592LD01HU-01 50 µg

GALNT17 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GALNT17 Antibody, Biotin conjugated
CSB-PA743592LD01HU-02 100 µg

GALNT17 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
MBS7620350-01 48 Well

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
MBS7620350-02 96 Well

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
MBS7620350-03 5x 96 Well

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
MBS7620350-04 10x 96 Well

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details