Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Six1 Peptide - N-terminal region

Six1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB138287

UniProt

Q62231

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Six1 Rabbit Polyclonal Antibody (orb576805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033215

Preservative

Lyophilized powder

AA Sequence

ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,4-Dichlorobenzyl iodide
OR111348-01 1 g

3,4-Dichlorobenzyl iodide

Sign In for Pricing
View Details
3,4-Dichlorobenzyl iodide
OR111348-02 5 g

3,4-Dichlorobenzyl iodide

Sign In for Pricing
View Details
Anti-Mouse CD45/LCA-R-PE-CY 7Conjugate Antibody
MBS4151718-01 0.1 mg

Anti-Mouse CD45/LCA-R-PE-CY 7Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD45/LCA-R-PE-CY 7Conjugate Antibody
MBS4151718-02 5x 0.1 mg

Anti-Mouse CD45/LCA-R-PE-CY 7Conjugate Antibody

Sign In for Pricing
View Details
Kcnh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3648907 1.0 µg DNA

Kcnh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Proteasome 20S C2 Rabbit Polyclonal Antibody (FITC)
orb3495 100 µL

Proteasome 20S C2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details