Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Six1 Peptide - N-terminal region

Six1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB138287

UniProt

Q62231

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Six1 Rabbit Polyclonal Antibody (orb576805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033215

Preservative

Lyophilized powder

AA Sequence

ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G2A siRNA (m)
sc-44371 10 µM

G2A siRNA (m)

Sign In for Pricing
View Details
Lentiviral human CCR5 shRNA (UAS) - Lentiviral human CCR5 shRNA (UAS, RFP) plasmid
GTR15327052 1 Vial

Lentiviral human CCR5 shRNA (UAS) - Lentiviral human CCR5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
SPATA20 Antibody
A73311-50UL 50 μL

SPATA20 Antibody

Sign In for Pricing
View Details
Human IL1RL1/ST2 ELISA Kit
EK5478 96 Tests

Human IL1RL1/ST2 ELISA Kit

Sign In for Pricing
View Details
mmu-miR-8105 miRNA Antagomir
MNM03202 2x 5.0 nmol

mmu-miR-8105 miRNA Antagomir

Sign In for Pricing
View Details
PLpro inhibitor 19
112209 5.0mg

PLpro inhibitor 19

Sign In for Pricing
View Details