Ska1 Peptide - middle region
Ska1 Peptide - middle region
Product Specifications
Product Name Alternative
2810433K01Rik, AV117428
UniProt
Q9CPV1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ska1 Rabbit Polyclonal Antibody (orb582770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079857
Preservative
Lyophilized powder
AA Sequence
LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BG-MUS11760 1 Each
Mouse Platelet Derived Growth Factor D PDGFD ELISA Kit
Sign In for Pricing
View Details 
orb2928828-01 20 µg
Recombinant Mouse Transmembrane protein C16orf54 homolog
Sign In for Pricing
View Details orb2928828-02 100 µg
Recombinant Mouse Transmembrane protein C16orf54 homolog
Sign In for Pricing
View Details 041680-Biotin 200 µL
SH2D1A, CT (SH2D1A, DSHP, SAP, SH2 domain-containing protein 1A, Duncan disease SH2-protein, Signaling lymphocytic activation molecule-associated protein, T-cell signal transduction molecule SAP) (Biotin) discontinued
Sign In for Pricing
View Details