Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA2 Peptide - N-terminal region

SLA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS

UniProt

Q9H6Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLA2 Rabbit Polyclonal Antibody (orb326344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115590

Preservative

Lyophilized powder

AA Sequence

GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF568 conjugate, 0.1mg/mL
BNC683347-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
γ-Aminobutyric Acid-d6
TRC-A602922-5MG 5 mg

γ-Aminobutyric Acid-d6

Sign In for Pricing
View Details
FHIT (NM_002012) Human Over-expression Lysate
LC419588 20 µg

FHIT (NM_002012) Human Over-expression Lysate

Sign In for Pricing
View Details
Sodium 5-Phenyl-1,3,4-oxadiazole-2-carboxylate
TRC-B526710-1G 1 g

Sodium 5-Phenyl-1,3,4-oxadiazole-2-carboxylate

Sign In for Pricing
View Details
RYK (NM_002958) Human Recombinant Protein
TP315509M 100 µg

RYK (NM_002958) Human Recombinant Protein

Sign In for Pricing
View Details