Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA2 Peptide - N-terminal region

SLA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS

UniProt

Q9H6Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLA2 Rabbit Polyclonal Antibody (orb326344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115590

Preservative

Lyophilized powder

AA Sequence

GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF647 conjugate, 0.1mg/mL
BNC472859-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pseudomonic Acid D Sodium (>90%)
TRC-P839520-5MG 5 mg

Pseudomonic Acid D Sodium (>90%)

Sign In for Pricing
View Details
PRA1 (RABAC1) (NM_006423) Human Over-expression Lysate
LY401932 100 µg

PRA1 (RABAC1) (NM_006423) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Nonanethiol
TRC-N649765-2.5G 2.5 g

1-Nonanethiol

Sign In for Pricing
View Details
Enramycin A
TRC-E556040-1MG 1 mg

Enramycin A

Sign In for Pricing
View Details
ZHX2 Antibody
8C11999-AAT 50 µg

ZHX2 Antibody

Sign In for Pricing
View Details