SLA2 Peptide - middle region
SLA2 Peptide - middle region
Product Specifications
Product Name Alternative
C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS
UniProt
Q9H6Q3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLA2 Rabbit Polyclonal Antibody (orb326345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115590
Preservative
Lyophilized powder
AA Sequence
WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6381669-01 0.1 mL
HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) (MaxLight 650)
Sign In for Pricing
View Details MBS6381669-02 5x 0.1 mL
HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) (MaxLight 650)
Sign In for Pricing
View Details 13288121 3x 1.0µg DNA
BEND7 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details MR209503L3V 200 µL
Wdr46 (NM_020603) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details