Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA2 Peptide - middle region

SLA2 Peptide - middle region

Product Specifications

Product Name Alternative

C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS

UniProt

Q9H6Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLA2 Rabbit Polyclonal Antibody (orb326345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115590

Preservative

Lyophilized powder

AA Sequence

WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RN (Interleukin 1 Receptor Antagonist, ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430) (APC)
247563-APC 100 µL

IL1RN (Interleukin 1 Receptor Antagonist, ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430) (APC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE), partial
MBS7068187 Inquire

Recombinant Escherichia coli O127:H6 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE), partial

Sign In for Pricing
View Details
MARH9 rabbit pAb Antibody
orb772505-01 50 μL

MARH9 rabbit pAb Antibody

Sign In for Pricing
View Details
MARH9 rabbit pAb Antibody
orb772505-02 100 µL

MARH9 rabbit pAb Antibody

Sign In for Pricing
View Details
BRD70326
MBS3607038 Inquire

BRD70326

Sign In for Pricing
View Details
Mouse Mucin-5 subtype AC (MUC5AC) ELISA Kit
RK04857 96 Tests

Mouse Mucin-5 subtype AC (MUC5AC) ELISA Kit

Sign In for Pricing
View Details