Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF1 Peptide - C-terminal region

SLAMF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD150, CDw150, SLAM

UniProt

B2RAL4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAMF1 Rabbit Polyclonal Antibody (orb333735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003028

Preservative

Lyophilized powder

AA Sequence

GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Immunoglobulin G2a (IgG2A) ELISA Kit
YLA0217MO-01 48 Tests

Mouse Immunoglobulin G2a (IgG2A) ELISA Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin G2a (IgG2A) ELISA Kit
YLA0217MO-02 96 Tests

Mouse Immunoglobulin G2a (IgG2A) ELISA Kit

Sign In for Pricing
View Details
Zfp13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4774606 1.0 µg DNA

Zfp13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA312229 100 µL

p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SIRPA (C-6His)
C385-01 10 µg

Recombinant Human SIRPA (C-6His)

Sign In for Pricing
View Details
Recombinant Human SIRPA (C-6His)
C385-02 50 µg

Recombinant Human SIRPA (C-6His)

Sign In for Pricing
View Details