Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF1 Peptide - C-terminal region

SLAMF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD150, CDw150, SLAM

UniProt

B2RAL4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAMF1 Rabbit Polyclonal Antibody (orb333735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003028

Preservative

Lyophilized powder

AA Sequence

GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lifitegrast Impurity 57
RM-L090657-01 10 mg

Lifitegrast Impurity 57

Sign In for Pricing
View Details
Lifitegrast Impurity 57
RM-L090657-02 25 mg

Lifitegrast Impurity 57

Sign In for Pricing
View Details
Lifitegrast Impurity 57
RM-L090657-03 50 mg

Lifitegrast Impurity 57

Sign In for Pricing
View Details
Lifitegrast Impurity 57
RM-L090657-04 100 mg

Lifitegrast Impurity 57

Sign In for Pricing
View Details
Rabbit anti-LARS Antibody, Affinity Purified
MBS3904510-01 0.01 mg

Rabbit anti-LARS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-LARS Antibody, Affinity Purified
MBS3904510-02 0.1 mg

Rabbit anti-LARS Antibody, Affinity Purified

Sign In for Pricing
View Details