Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc10a2 Peptide - N-terminal region

Slc10a2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASBT, ISBT

UniProt

P70172

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc10a2 Rabbit Polyclonal Antibody (orb330338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035518

Preservative

Lyophilized powder

AA Sequence

GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl (1R,2S) -2- (4-Fluorobenzylamino) cyclopentanecarboxylate
PC510025 1 Each

Ethyl (1R,2S) -2- (4-Fluorobenzylamino) cyclopentanecarboxylate

Sign In for Pricing
View Details
Hsa-miR-6754-3p miRNA Inhibitor
CIH2172-01 10 nmol

Hsa-miR-6754-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6754-3p miRNA Inhibitor
CIH2172-02 20 nmol

Hsa-miR-6754-3p miRNA Inhibitor

Sign In for Pricing
View Details
APBA2 Rabbit Polyclonal Antibody
orb2954685-01 50 µg

APBA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APBA2 Rabbit Polyclonal Antibody
orb2954685-02 100 µg

APBA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-WNT5B Antibody (R3Z65)
RHK97402 100 μg

Anti-WNT5B Antibody (R3Z65)

Sign In for Pricing
View Details